Protein Info for Rru_A1701 in Rhodospirillum rubrum S1H

Annotation: Methionyl-tRNA synthetase, class Ia (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 PF00133: tRNA-synt_1" amino acids 5 to 62 (58 residues), 37 bits, see alignment 4.7e-13 amino acids 226 to 338 (113 residues), 51.2 bits, see alignment E=2.2e-17 TIGR00398: methionine--tRNA ligase" amino acids 8 to 482 (475 residues), 512.8 bits, see alignment E=5.8e-158 PF09334: tRNA-synt_1g" amino acids 9 to 366 (358 residues), 356.6 bits, see alignment E=3.9e-110 PF01406: tRNA-synt_1e" amino acids 17 to 138 (122 residues), 29.3 bits, see alignment E=1.5e-10 PF19303: Anticodon_3" amino acids 377 to 515 (139 residues), 53.9 bits, see alignment E=4.8e-18 PF08264: Anticodon_1" amino acids 389 to 479 (91 residues), 28.6 bits, see alignment E=3e-10

Best Hits

Swiss-Prot: 62% identical to SYM_RHILO: Methionine--tRNA ligase (metG) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01874, methionyl-tRNA synthetase [EC: 6.1.1.10] (inferred from 100% identity to rru:Rru_A1701)

Predicted SEED Role

"Methionyl-tRNA synthetase (EC 6.1.1.10)" (EC 6.1.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTP4 at UniProt or InterPro

Protein Sequence (519 amino acids)

>Rru_A1701 Methionyl-tRNA synthetase, class Ia (NCBI) (Rhodospirillum rubrum S1H)
MAGPKPPFYLTTPIYYVNDKPHIGHAYTTLACDVLARFKRLDGFDVKFLTGTDEHGQKVQ
KSATAAGIDPQTFTDRVSANFRDLAAAMNFSNDAFIRTTEPRHKEACKALWTLLVERGEI
YLDAYRGWYAVRDEAFYGEDELTTAADGSRLAPTGAPVEWVEEPSYFFRLSKWQQPLLDL
YAARPDFIAPDSRRNEVISFVKGGLTDLSISRTTFSWGVPVPGDEDHVMYVWLDALTNYI
TAVGFPDQTGDYARYWPANLHMVGKDILRFHTVYWPAFLMAAGLEVPGRVFAHGWWTNEG
QKISKSVGNVIDPRALIETYGLDPVRYFLLREVPFGNDGDFSHRAMINRMNGELANDLGN
LAQRVLSMIAKNCAGAVPEPGPFSEDDDALLAAAVALLDKVRQAMDRQAFHEALEAIWVV
IRAANGYVDRQAPWALRKNDPPRMATVLYVLAEVIRRVALLMQPFVPASAARMLDQLGQG
PEARDTTALGDRPLLAPGTVLPKPEGIFPRHVVDDEGAA