Protein Info for Rru_A1677 in Rhodospirillum rubrum S1H

Annotation: Signal transduction histidine kinase, nitrogen specific, NtrB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF13188: PAS_8" amino acids 20 to 73 (54 residues), 20.4 bits, see alignment 7.3e-08 PF00989: PAS" amino acids 20 to 112 (93 residues), 26.8 bits, see alignment E=8.9e-10 PF00512: HisKA" amino acids 144 to 200 (57 residues), 52.2 bits, see alignment E=1e-17 PF02518: HATPase_c" amino acids 247 to 364 (118 residues), 63 bits, see alignment E=7e-21

Best Hits

Swiss-Prot: 59% identical to NTRB_AZOBR: Sensory histidine kinase/phosphatase NtrB from Azospirillum brasilense

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 100% identity to rru:Rru_A1677)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTR8 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Rru_A1677 Signal transduction histidine kinase, nitrogen specific, NtrB (NCBI) (Rhodospirillum rubrum S1H)
MVKISALTRRAPVPSIDPATVLSAIASAVICVDEADRVQFVNAAGEQMFESTWALLRGMA
LSDLIPPDCPIFGLMEKVRRNHSTFSEYGVQLDTPRTGQRTITVRVSPLAEYENWVVISL
HELSMALKIGQQMSHRNAARSVTAMAALLAHEVKNPLSGIRGAAQLLEANLPEEDHQLVR
LIIDETDRIVALVDRMEVFSDNMPLAREAVNIHRVLEHVRMVAENGFARGVRFVETYDPS
LPAVLGSRDQLIQVFLNLIKNAAEAIGPGGGEIVLSTAYQQGLRLRVPGGEVTDLPLVIS
VRDNGTTGISEDLRGNLFDPFVTTKPKGSGLGLPLVAKIVNDHGGIIEFDSVPGRTVFTV
MLPMVR