Protein Info for Rru_A1667 in Rhodospirillum rubrum S1H

Annotation: Beta-ketoacyl-acyl carrier protein synthase III (FabH) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 4 to 323 (320 residues), 395.7 bits, see alignment E=7.4e-123 PF00108: Thiolase_N" amino acids 44 to 146 (103 residues), 37.4 bits, see alignment E=2.9e-13 PF08545: ACP_syn_III" amino acids 108 to 191 (84 residues), 111.1 bits, see alignment E=2.8e-36 PF08541: ACP_syn_III_C" amino acids 235 to 323 (89 residues), 119.2 bits, see alignment E=1.1e-38

Best Hits

Swiss-Prot: 100% identical to FABH_RHORT: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to rru:Rru_A1667)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTS8 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Rru_A1667 Beta-ketoacyl-acyl carrier protein synthase III (FabH) (NCBI) (Rhodospirillum rubrum S1H)
MWRSVIAGCGSYLPANKVTNANLAERVETTDAWIRERTGILVRHFAAEGEKTSDLAMAAA
RAALADAGVDAAEVDLIVLATATPDQTFPATATRVQAGLGCRPGAPAFDIQAVCSGFLYA
LSVADALIKAGQARTALVIGAETFSRILDFTDRTTCVLFGDGAGAVVLRATPSTGDGGER
GILSTHLHADGRHHDLLYVDGGPSSTGTVGHLRMQGREVFRHAVTNLYEVVLEALAANGL
QADAIDWVVPHQANQRILDGTAKKLGIDPAKVISTIALHANTSAASVPLALCEARRDGRI
QPGQLILLEAMGGGFTWGSALVRL