Protein Info for Rru_A1666 in Rhodospirillum rubrum S1H

Annotation: Fatty acid synthesis plsX protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02504: FA_synthesis
  • amino acids 6 to 327 (322 residues), 355.7 bits, E=1.1e-110
• TIGR00182: fatty acid/phospholipid synthesis protein PlsX
  • amino acids 7 to 336 (330 residues), 310.8 bits, E=5.9e-97

Best Hits

Swiss-Prot: 100% identical to PLSX_RHORT: Phosphate acyltransferase (plsX) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 100% identity to rru:Rru_A1666)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• diacylglycerol and triacylglycerol biosynthesis (2/7 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• anandamide biosynthesis I (3/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

See Q2RTS9 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Rru_A1666 Fatty acid synthesis plsX protein (NCBI) (Rhodospirillum rubrum S1H)
MSNSLVISVDAMGGDDAPDMVVDGVKLARKRFPDVRFLLFGDEARIGPLVAGDSALSAVC
TIRHTASAVSGDAKPSQAVRSGRQSSLWLSIEAVKKGEAAGVVSAGNTGAFMAMAKLILR
TLPGIDRPAIATLLPTLRGESVVLDLGANAECNANNLVEFAIMGEVFARTVLSLDRPTVG
IMNIGSESGKGTDTVRDASARLQDSALPIRFMGFVEGDDLGKGTVDVIVTDGFTGNVMLK
TAEGTAKLYSQFLRNAFLSSLLARLGYLLSRSALQKVKARTDPRRYNGAMFLGLDGVAVK
SHGGTDALGFSNALAVAIDLVRQGFNESIKDEIAKVQVLPSTVSVSHAV