Protein Info for Rru_A1658 in Rhodospirillum rubrum S1H

Annotation: AMP-dependent synthetase and ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 25 to 404 (380 residues), 266.5 bits, E=3.5e-83
• PF13193: AMP-binding_C
  • amino acids 454 to 528 (75 residues), 73.9 bits, E=1.7e-24

Best Hits

Swiss-Prot: 48% identical to AAE6_ARATH: Probable acyl-activating enzyme 6 (AAE6) from Arabidopsis thaliana

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 100% identity to rru:Rru_A1658)

Predicted SEED Role

"3-methylmercaptopropionyl-CoA ligase (DmdB)"

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Caprolactam degradation
• Ethylbenzene degradation
• Geraniol degradation
• Limonene and pinene degradation
• Propanoate metabolism
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

See Q2RTT7 at UniProt or InterPro

Protein Sequence (542 amino acids)

>Rru_A1658 AMP-dependent synthetase and ligase (NCBI) (Rhodospirillum rubrum S1H)
MPSPYSTGLDRTPANHVPLTPLAFLDRAAQVFPDRPSLVHGKRRYTWAETAQRARRLASA
LRARGIGPEDTVAVMGANTPELYEAHFGVPMAGAVLNALNVRLNAEEIAFILEHGEARVL
LTDTEFSPIIADALARIDRPITVIDIVDPEYDGPGACVGEMEYEAFLAEGDPTADWRWPA
DEWESITLNYTSGTTGNPKGVVYHHRGAYLNALSNIITWGMPHHAVYLWTLPMFHCNGWC
FPWTMAANAGTNVCLRRVTAAGIFQAIAEEKVSHFCGAPIVLSFLINARPEERRSFDHQV
NVMTAAAPPPASVLEKMQREGFCVTHVYGLTETYGPATVCAWKEPWNDLPMDEQARLKSR
QGVRYLVQEGLMVGDPETMEAVPADGESMGEVFFRGNITMKGYLKNPEATAEAFRGGWFH
TGDLGVLHPDGYLQLKDRSKDIIISGGENISSIEVEGVLHRHPDVVAAAVVAKPDEKWGE
TPKAYVELRDGATVTEDELVAFCRLHLAHYKCPRDVEVGPLPKTSTGKIQKFVLRRQVRA
EG