Protein Info for Rru_A1657 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 118 (27 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details PF03825: Nuc_H_symport" amino acids 2 to 353 (352 residues), 52.6 bits, see alignment E=7.7e-18 PF12832: MFS_1_like" amino acids 3 to 348 (346 residues), 199.2 bits, see alignment E=2.2e-62 PF01306: LacY_symp" amino acids 5 to 170 (166 residues), 36.1 bits, see alignment E=7.2e-13 PF07690: MFS_1" amino acids 5 to 345 (341 residues), 51.2 bits, see alignment E=1.9e-17

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 100% identity to rru:Rru_A1657)

Predicted SEED Role

"Probable 3-phenylpropionic acid transporter" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTT8 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Rru_A1657 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MALRLSLLYAALFAIVGVTLPFWPLWLADRGLAPTEIAIVAGAAIWSKILVNPLAGSLAD
ALGRRRAVMLGLAAASLALYGALALVQGFWPILILAVAASSLFTALMPLTETVTLAALRF
GGLDYGRVRLWGSVSFIALAMGLGPVIAAFGAGVISWTIVALLGVVLAVLPGMPDPPEGR
RGATGGARLGGGRLPRDGGMLGLLTNGRFVLFLISDGLIQAGHATYYALGSVHWHKAGLG
ETQVGLLWAEGVVAEVLLFAFGAPLVRLCGPFGLLGLAAAAGVARWSITAWTTDPAILAL
IQPLHGLTFAAAHLGSMHHITRSIPTDRAARAQALYSAVCAGMIMGAAMTLAGPAYAALG
GRAFLVDALWCALGGLGIGLLALIARRDGATRRRA