Protein Info for Rru_A1653 in Rhodospirillum rubrum S1H

Annotation: guanylate cyclase (GGDEF domain) with PAS/PAC sensor and Response Regulator Receiver modulation (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF00072: Response_reg" amino acids 9 to 120 (112 residues), 64.5 bits, see alignment E=3.5e-21 PF13188: PAS_8" amino acids 139 to 185 (47 residues), 25.6 bits, see alignment 3.1e-09 PF00989: PAS" amino acids 139 to 247 (109 residues), 48.8 bits, see alignment E=2.3e-16 TIGR00229: PAS domain S-box protein" amino acids 139 to 257 (119 residues), 67.1 bits, see alignment E=1.6e-22 PF08448: PAS_4" amino acids 143 to 252 (110 residues), 37.1 bits, see alignment E=1.2e-12 PF13426: PAS_9" amino acids 147 to 248 (102 residues), 51 bits, see alignment E=5.2e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 259 to 421 (163 residues), 163 bits, see alignment E=5e-52 PF00990: GGDEF" amino acids 261 to 418 (158 residues), 167.7 bits, see alignment E=6.7e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1653)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTU2 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Rru_A1653 guanylate cyclase (GGDEF domain) with PAS/PAC sensor and Response Regulator Receiver modulation (NCBI) (Rhodospirillum rubrum S1H)
MLFDRTIDVLLVEDNPGDSRLIQINLSEQHEVRFRVRVCEDLASACACLASARFDVVLLD
LFLPDSQGLRTLERLMVATNEIPVVVMSGLDDFTTAMQAVQQGAQDYLVKGKGDGELVRR
AILHAIERQRFRRQLLMAEAAFRHTDTGMMVTDAHGVVVRVNPAFLDVTGYGADEVVGRM
APFLRSDVHDGDFYRDIWKRLGETSTWEGEIWTRRRNGEIAPDWLRINGVTDPSGGVVGY
VVVFSDITFRRRAEEELVRQATTDPLTGLPNRALFQKLLVSGLERARRYDRHLGLLFVDI
DGFKQVNDRFGHEGGDEVLREVARRLRRAVRVSDEVARLGGDEFTLLLSEVKAESDVETV
AAKVVQVLGEAFSIEDQPLVLSASVGVALSPADGRDAESLLRAADEAMYRAKRGGKNRYA
LASAAPGQTPPPR