Protein Info for Rru_A1639 in Rhodospirillum rubrum S1H

Annotation: Na+/H+ antiporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details PF03334: PhaG_MnhG_YufB" amino acids 14 to 90 (77 residues), 82.4 bits, see alignment E=1.1e-27 TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 14 to 96 (83 residues), 73.2 bits, see alignment E=8.2e-25

Best Hits

KEGG orthology group: K05571, multicomponent Na+:H+ antiporter subunit G (inferred from 100% identity to rru:Rru_A1639)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTV6 at UniProt or InterPro

Protein Sequence (116 amino acids)

>Rru_A1639 Na+/H+ antiporter subunit (NCBI) (Rhodospirillum rubrum S1H)
MSLVFDLISWLGFTIGGAFLIIGAIGVLRMPDLYTRLHAASLVDTLGAGMMIGAMMVQSG
LTLGTVKLALVMVFLALTGPVSSHALAGSALRGGLWPLGCDDRSGLWASRLEQDRP