Protein Info for Rru_A1638 in Rhodospirillum rubrum S1H

Annotation: putative multicomponent Na+-H+ antiporter subunit A (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 30 to 51 (22 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details PF13244: MbhD" amino acids 16 to 77 (62 residues), 58.5 bits, see alignment E=6e-20 PF20501: MbhE" amino acids 118 to 173 (56 residues), 33.9 bits, see alignment E=2.8e-12

Best Hits

KEGG orthology group: K05566, multicomponent Na+:H+ antiporter subunit B (inferred from 100% identity to rru:Rru_A1638)

Predicted SEED Role

"PH adaptation potassium efflux system protein B1; sodium- potassium/hydrogen antiporter subunit B1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTV7 at UniProt or InterPro

Protein Sequence (199 amino acids)

>Rru_A1638 putative multicomponent Na+-H+ antiporter subunit A (NCBI) (Rhodospirillum rubrum S1H)
MIDDPGLWIDIAMFACLAATALAMLKGRDLFPVAMLSGIFSLLSAGIFTLLDAVDVAFTE
ASVGAGITTVLFLGTISLVGNREKPVRRANWPALVTVLLTGAMLIWATLDMPAFGDPAAP
IHHHVADHYIAESGREIGMPNIVTSVLASYRGFDTLGETTVIFTAGMAVVVLLGGAPLLA
PFRRKRKEAPPPKTAPGGE