Protein Info for Rru_A1635 in Rhodospirillum rubrum S1H

Annotation: NADH dehydrogenase (quinone) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 53 (23 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 236 to 252 (17 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 465 to 488 (24 residues), see Phobius details PF10125: NADHdeh_related" amino acids 82 to 219 (138 residues), 30.9 bits, see alignment E=1.9e-11 PF00361: Proton_antipo_M" amino acids 132 to 427 (296 residues), 200.1 bits, see alignment E=4.8e-63

Best Hits

KEGG orthology group: K05568, multicomponent Na+:H+ antiporter subunit D (inferred from 100% identity to rru:Rru_A1635)

Predicted SEED Role

"NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTW0 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Rru_A1635 NADH dehydrogenase (quinone) (NCBI) (Rhodospirillum rubrum S1H)
MIPTHLPILQVVVPLMAAPVCILLRRPGLCWAWALLIALTTLTMAVGLLAGVLTHGPSAY
HLGDWSPPWGIELHVDLLSALVLVLVTATASLVIVYARASFAAEIDPGHHTLAYCLFLLC
LTGLLGMAITGDAFNLFVFLEISSLSSYALVALGRDRRALYAAYHYLILGTVGATFYVIG
IGFLYMMTGTLNMNDLAQRLPAVAHSRTAVAGVVFLGVGLSLKLALFPLHKWLPAAYSYA
PSAVGAFLAATSTKVAFYVMVRLFLGVLAPAFSANLLPGPVSAREMVMVLALAAILSGSF
SAIFQSDAKRLLAYSSVSQIGVMVLGLSLFSLDGVAGGLVHMLNHALIKASLFMALGCVF
LRIGSVEIADMAGIGRRMPWTMAAFVIGGLSLIGIPGTAGFISKWQLAQSAIAEGWWLAV
AALIASSLLAVVYVGKVIEAAYFRPSPAESPSGAPSAPQEAPAMMLAPLWIAALANIGFG
LNTTWTLGLAKRAASALMGLPS