Protein Info for Rru_A1612 in Rhodospirillum rubrum S1H

Annotation: Phosphoribosyl-AMP cyclohydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01502: PRA-CH" amino acids 39 to 112 (74 residues), 120.6 bits, see alignment E=9.4e-40

Best Hits

Swiss-Prot: 100% identical to HIS3_RHORT: Phosphoribosyl-AMP cyclohydrolase (hisI) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 100% identity to rru:Rru_A1612)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTY3 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Rru_A1612 Phosphoribosyl-AMP cyclohydrolase (NCBI) (Rhodospirillum rubrum S1H)
MKNTSALAETAALWAAVRFTADGLVPVIAQQHDSGEVLMMAWMNREALEETLVTGKACYW
SRSRGRLWRKGESSGQTQKVLALRLDCDGDTILLLVDQTGVACHTGRRSCFFNEVGPTGE
ITVVSAPLVTPEALYGAEGHSHP