Protein Info for Rru_A1602 in Rhodospirillum rubrum S1H

Annotation: ComEC/Rec2-related protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 739 transmembrane" amino acids 43 to 63 (21 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 358 to 389 (32 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 435 to 457 (23 residues), see Phobius details amino acids 464 to 492 (29 residues), see Phobius details amino acids 500 to 520 (21 residues), see Phobius details amino acids 532 to 549 (18 residues), see Phobius details amino acids 556 to 572 (17 residues), see Phobius details PF13567: DUF4131" amino acids 67 to 221 (155 residues), 41.1 bits, see alignment E=1.5e-14 PF03772: Competence" amino acids 268 to 552 (285 residues), 196.5 bits, see alignment E=5.7e-62 TIGR00360: ComEC/Rec2-related protein" amino acids 290 to 484 (195 residues), 82.1 bits, see alignment E=2.8e-27

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 100% identity to rru:Rru_A1602)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTZ3 at UniProt or InterPro

Protein Sequence (739 amino acids)

>Rru_A1602 ComEC/Rec2-related protein (NCBI) (Rhodospirillum rubrum S1H)
MRKQSEDDGQKEAGGVASFDEEEDIDPGPRIGPLARLLVAERAVWALWLPVALGLGIALY
FSLKTEPPAWVAPAVLALLALASPHVRARDGLTAASRGVMALVIGFCVAQAWALGVAAPV
IEREGRPGLIEGRVVANEPLDRGWRMILDDLTIEGLEAAKTPRRIRLRLHPGQTGGVAPL
PGSRIAVLGQLAPPPTPVAPGVFDFARGLWFERIGGVGFALGPLRGRGSLAEGPVPRIRA
AIQGWRQGVTARIIAAEPTLHGPLTAALITGEQRAIDPEIQEAMRASGLSHLLAISGLNM
SLAAGLMFVLVRGGLALWPRAALLWPIKKLAAAAALAGCAAYLVLSGAGVPAERAFIMTG
LVLLAVLVDRTALSMRTLALAGVAVLLIAPESLMGASFQMSFAAVIALIATYGALGPQAG
RWRAGGGGGMGRAAALYLGGVALSTVVATVATLPYGAYHFHRVALYGVVANMIAVPLTGF
WVMPWCLVLLALMPFGLEGLAMAPLGWGLDGIVAVARWVGGWPGALLAIPDGPGWALGLV
SLGGLWLCLWTRPWRLAGVVPILVGMTVPWLTPPPDVLINDEGTLIAVRAAGGQLVFSDF
RKARFTREVWGEAFGGAAGEGRFPVAGASADGRLVCDGEGCLYRRPGLVIALPRTLGAAF
EDRALADLVIVPFARFASPPPPLAPGRGPGWIIDRGDLIGGGAHALWIADDGQVTLRTVA
GERGHRPWTGKPGPGDGAR