Protein Info for Rru_A1599 in Rhodospirillum rubrum S1H

Annotation: Lipid-A-disaccharide synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 TIGR00215: lipid-A-disaccharide synthase" amino acids 12 to 370 (359 residues), 229.3 bits, see alignment E=3.5e-72 PF02684: LpxB" amino acids 12 to 372 (361 residues), 288.8 bits, see alignment E=3e-90

Best Hits

Swiss-Prot: 48% identical to LPXB_RHOCS: Lipid-A-disaccharide synthase (lpxB) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00748, lipid-A-disaccharide synthase [EC: 2.4.1.182] (inferred from 100% identity to rru:Rru_A1599)

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.182

Use Curated BLAST to search for 2.4.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTZ6 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Rru_A1599 Lipid-A-disaccharide synthase (NCBI) (Rhodospirillum rubrum S1H)
MTTTDQDQGPLIYIIAGEPSGDQLGAQIMRGLKIETAGRVRFAGIGGEQMAEEGLNSLVP
LTELAVMGFLEVIPSALRILRRLRQTLADIALKRPDAVVTIDSWGFTGRIHAGLKKAGNP
AVRLHYVAPMVWAWNAGRVHHVAARVDHLMCLWPFEPPLFEAAGLASSHVGHPVIETPAG
AGNGPAFRQAHDIAAEAPLLVVLPGSRRGEVRRLLPVFAAAVEKLADRHPDLRVVIPTLT
YLRSYLLDETASWPVEVSVVTGQSGKFDAFAAANAAIAASGTVSLELAMAGTPHLIAYRV
NGLTAEIAKRLVTVRFADMVNILLDRPAIPELLQTECTPAKLAETAERLMTDETTRRDQR
AAMAEAVSQLGGRDDPPSRRAARLILSKIALERDGEKCARFSPKIPL