Protein Info for Rru_A1578 in Rhodospirillum rubrum S1H

Annotation: Lipoprotein releasing system, transmembrane protein, LolC/E family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 22 to 49 (28 residues), see Phobius details amino acids 274 to 298 (25 residues), see Phobius details amino acids 318 to 344 (27 residues), see Phobius details amino acids 355 to 372 (18 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 6 to 417 (412 residues), 478.5 bits, see alignment E=8.9e-148 PF12704: MacB_PCD" amino acids 31 to 243 (213 residues), 56.5 bits, see alignment E=4.9e-19 PF02687: FtsX" amino acids 277 to 410 (134 residues), 53.8 bits, see alignment E=1.9e-18

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to rru:Rru_A1578)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU17 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Rru_A1578 Lipoprotein releasing system, transmembrane protein, LolC/E family (NCBI) (Rhodospirillum rubrum S1H)
MIFNAFERMMAGRYLRARRKEGFVSVIAGFSLAGIGLGVATLIIVMAVMNGFREDLMGRI
FGLNGHLTVLGQYDVMMDYDRATDIIRGIPGVRAVTPTVEGQVMLTDNGRSVGGLVRGVR
PEDLRQRPMLANAVIAGSLDDLRGQDSIMIGNRLAENFGLRVGDKLTLVSPKGKVTAMGT
VPRVRAYTVRVIFSIGMSEYDSSFVFLPLEAAQTYFQVPTEGVNHLEVVVDHPDRVGEVA
GTIASTNGLGGIRLRDWRQTNATFFNALQVERNVMFLILTLIIVVAAFNIISGLIMLVKD
KGRDIAILRTMGASRGAIMRIFFLAGAAVGVTGTLAGLLLGVLFCQNIEAIRQGLQSLLG
VELFNAEIYFLATMPATMDPHEVMNVVLMALGLSFAATLYPAWRAARTDPVEALRNE