Protein Info for Rru_A1576 in Rhodospirillum rubrum S1H

Annotation: Prolyl-tRNA synthetase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR00409: proline--tRNA ligase" amino acids 1 to 222 (222 residues), 332.8 bits, see alignment E=2.5e-103 PF00587: tRNA-synt_2b" amino acids 98 to 325 (228 residues), 88.8 bits, see alignment E=4.9e-29 PF03129: HGTP_anticodon" amino acids 345 to 433 (89 residues), 61.9 bits, see alignment E=5.3e-21

Best Hits

Swiss-Prot: 100% identical to SYP_RHORT: Proline--tRNA ligase (proS) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01881, prolyl-tRNA synthetase [EC: 6.1.1.15] (inferred from 100% identity to rru:Rru_A1576)

Predicted SEED Role

"Prolyl-tRNA synthetase (EC 6.1.1.15), bacterial type" (EC 6.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU19 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Rru_A1576 Prolyl-tRNA synthetase (NCBI) (Rhodospirillum rubrum S1H)
MRLSRFLLPTLKETPSEAEIVSHRLMLRAGMIRQHASGIYNWLPLGLRVLRKIEQVVREE
QDATGAQEILMPTIQSADLWRESGRYDDYGKEMLRIVDRHERDMLYGPTHEEVATDVFRK
NVKSYRALPQNLYQIQWKFRDEVRPRFGVMRGREFLMKDNYSFDLTYEGARHSYNKMFVA
YLRTFARLGLKAIPMAADTGPIGGKLSHEFIILADTGESAVFCHRDLLDKPAPENVDYDS
DLQPLVDSWTSLYAATDEMHRPDHGVPEGDLVSARGIEVGHIFHFGTKYSAPMGATVTAP
DGSSQAVFMGSYGIGVSRLVAGIIEASHDDNGIIWPDGVAPFDIGVINLKVGDAATDGVC
ADLYGRLRAAGKDVLFDDTDDRAGAKFATMDLIGLPWQVIAGPKGVAKGMVELKERATGE
RHELSIDSALAKLLG