Protein Info for Rru_A1565 in Rhodospirillum rubrum S1H

Annotation: NADH-ubiquinone oxidoreductase, chain 4L (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 55 (24 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details PF00420: Oxidored_q2" amino acids 7 to 102 (96 residues), 105.4 bits, see alignment E=5.1e-35

Best Hits

Swiss-Prot: 79% identical to NUOK_PARL1: NADH-quinone oxidoreductase subunit K (nuoK) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 100% identity to rru:Rru_A1565)

MetaCyc: 48% identical to ferredoxin-plastoquinone oxidoreductase subunit E (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU30 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Rru_A1565 NADH-ubiquinone oxidoreductase, chain 4L (NCBI) (Rhodospirillum rubrum S1H)
MEITLAHYLTVAAILFTLGVFGIFANRKNVVTILMSVELMLLAVNINMVAFSTYLQDMVG
QIFSMFILTVAAAEAGIGLAIVVVFFRNRGSIEVEDINQMKG