Protein Info for Rru_A1563 in Rhodospirillum rubrum S1H

Annotation: NADH-quinone oxidoreductase, chain I (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 19 to 140 (122 residues), 167.6 bits, E=3.9e-54
• PF00037: Fer4
  • amino acids 60 to 79 (20 residues), 24 bits, see alignment (E = 1.4e-08)
  • amino acids 96 to 117 (22 residues), 35.7 bits, see alignment (E = 2.9e-12)
• PF12800: Fer4_4
  • amino acids 61 to 75 (15 residues), 18 bits, see alignment (E = 1.6e-06)
  • amino acids 100 to 114 (15 residues), 13.5 bits, see alignment (E = 4.3e-05)
• PF13187: Fer4_9
  • amino acids 62 to 117 (56 residues), 35.4 bits, E=5e-12
• PF12838: Fer4_7
  • amino acids 62 to 116 (55 residues), 47.5 bits, E=1.1e-15

Best Hits

Swiss-Prot: 100% identical to NUOI_RHORT: NADH-quinone oxidoreductase subunit I (nuoI) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 100% identity to rru:Rru_A1563)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See Q2RU32 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Rru_A1563 NADH-quinone oxidoreductase, chain I (NCBI) (Rhodospirillum rubrum S1H)
MTSIVRTLRSLTLWELVSGMALTFRYMLKPKVTINYPFEKGYLSPRFRGEHALRRYANGE
ERCIACKLCEAICPAQAITIEAEPRTDGSRRTTRYDIDMTKCIYCGFCEEACPVDAIVEG
PNFEFAAETREELLYNKAKLLANGDRWEPELALRLRKDAAYR