Protein Info for Rru_A1562 in Rhodospirillum rubrum S1H

Annotation: Respiratory-chain NADH dehydrogenase, subunit 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00146: NADHdh
  • amino acids 18 to 326 (309 residues), 439.2 bits, E=4.1e-136

Best Hits

Swiss-Prot: 100% identical to NUOH_RHORT: NADH-quinone oxidoreductase subunit H (nuoH) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to rru:Rru_A1562)

MetaCyc: 100% identical to MbhM (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• hydrogen production VI (2/2 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• superpathway of photosynthetic hydrogen production (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (6/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism
• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2, 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

See Q2RU33 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Rru_A1562 Respiratory-chain NADH dehydrogenase, subunit 1 (NCBI) (Rhodospirillum rubrum S1H)
MADFWGGYLWPAIIIVLQCLAIILPMLGAIAYLTYAERKVIGAMQMRKGPNVVGPFGLLQ
PLADGVKLFLKETIIPTGANRAVFIIAPLMTFILALIAWAVIPFDAGWVVADINVGVLYL
FAVSGLGVYGIIMAGWASNSKYAFLGGLRSAAQMVSYEVAMGLIIIAVILSAGSMNLSDI
VEAQRQGVWYFIPHFPMFVMFLVSILAETNRAPFDLPEAEAELVSGYNVEYSAMPFALFF
LGEYGNMILMSGITAILFLGGWLPPVDIAPFNWIPGIIWFFLKIALILFVFLWVRATFPR
YRYDQLMRLGWKVFLPGSLIWVVLTAGFLVTFDMLPR