Protein Info for Rru_A1562 in Rhodospirillum rubrum S1H

Annotation: Respiratory-chain NADH dehydrogenase, subunit 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details PF00146: NADHdh" amino acids 18 to 326 (309 residues), 439.2 bits, see alignment E=4.1e-136

Best Hits

Swiss-Prot: 100% identical to NUOH_RHORT: NADH-quinone oxidoreductase subunit H (nuoH) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to rru:Rru_A1562)

MetaCyc: 100% identical to MbhM (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2, 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU33 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Rru_A1562 Respiratory-chain NADH dehydrogenase, subunit 1 (NCBI) (Rhodospirillum rubrum S1H)
MADFWGGYLWPAIIIVLQCLAIILPMLGAIAYLTYAERKVIGAMQMRKGPNVVGPFGLLQ
PLADGVKLFLKETIIPTGANRAVFIIAPLMTFILALIAWAVIPFDAGWVVADINVGVLYL
FAVSGLGVYGIIMAGWASNSKYAFLGGLRSAAQMVSYEVAMGLIIIAVILSAGSMNLSDI
VEAQRQGVWYFIPHFPMFVMFLVSILAETNRAPFDLPEAEAELVSGYNVEYSAMPFALFF
LGEYGNMILMSGITAILFLGGWLPPVDIAPFNWIPGIIWFFLKIALILFVFLWVRATFPR
YRYDQLMRLGWKVFLPGSLIWVVLTAGFLVTFDMLPR