Protein Info for Rru_A1529 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, ArsR family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF12840: HTH_20" amino acids 12 to 59 (48 residues), 33.4 bits, see alignment 2.3e-11 PF01022: HTH_5" amino acids 14 to 58 (45 residues), 45.1 bits, see alignment 4.7e-15 PF12802: MarR_2" amino acids 19 to 62 (44 residues), 42.2 bits, see alignment 4.8e-14 PF13412: HTH_24" amino acids 19 to 58 (40 residues), 28.3 bits, see alignment 7.1e-10 PF13489: Methyltransf_23" amino acids 146 to 261 (116 residues), 48.1 bits, see alignment E=7.1e-16 PF01209: Ubie_methyltran" amino acids 148 to 253 (106 residues), 42.1 bits, see alignment E=4.5e-14 PF13847: Methyltransf_31" amino acids 151 to 255 (105 residues), 79.4 bits, see alignment E=1.5e-25 PF05175: MTS" amino acids 151 to 249 (99 residues), 31.8 bits, see alignment E=7.3e-11 PF01135: PCMT" amino acids 151 to 249 (99 residues), 25.6 bits, see alignment E=6.3e-09 PF13649: Methyltransf_25" amino acids 153 to 245 (93 residues), 80 bits, see alignment E=1.2e-25 PF08241: Methyltransf_11" amino acids 153 to 249 (97 residues), 92.3 bits, see alignment E=1.5e-29 PF08242: Methyltransf_12" amino acids 153 to 247 (95 residues), 59.6 bits, see alignment E=2.7e-19

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to rru:Rru_A1529)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU66 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Rru_A1529 Transcriptional Regulator, ArsR family (NCBI) (Rhodospirillum rubrum S1H)
MEVVLSGLRAAAESTRLRLLALCAHGDLTVSDLVRILGISQPRVSRHLKVMCESGLLERI
REGAWVFYRLAPQGVGAEVARSIVGMLPESDPELALDRERLATIRAARAVEAAAYFRANA
AHWDDLRGLFGSDRPVEEALRGYFIDRPLEDFLDIGTGTGRILDVMSPHAERCVGIDQSR
EMLAVARANLERAGVRNGHVRQGDMYALPFAAASFDGIVIHQVLHFAEDPAAVIAEAARV
LRPGGRLAIADLAPHQREELREEHNHRRLGFSAGEITGWCAGVGLVARDCLDLAGRELVV
RLWVADRPPVATPALRSESAPSVSSSHAAFDQGSSPS