Protein Info for Rru_A1503 in Rhodospirillum rubrum S1H

Annotation: Zinc-containing alcohol dehydrogenase superfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF08240: ADH_N" amino acids 37 to 156 (120 residues), 95.5 bits, see alignment E=3.3e-31 PF00107: ADH_zinc_N" amino acids 195 to 318 (124 residues), 86.8 bits, see alignment E=1.9e-28

Best Hits

Swiss-Prot: 54% identical to ADHA_BACSU: Probable formaldehyde dehydrogenase AdhA (adhA) from Bacillus subtilis (strain 168)

KEGG orthology group: K13979, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 100% identity to rru:Rru_A1503)

MetaCyc: 54% identical to S-(hydroxymethyl)bacillithiol dehydrogenase (Bacillus subtilis subtilis 168)
RXN-18814 [EC: 1.1.1.306]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1

Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.306

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU91 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Rru_A1503 Zinc-containing alcohol dehydrogenase superfamily (NCBI) (Rhodospirillum rubrum S1H)
MLYQEHPPLSIPTLGFAAQSATTPLAPFSFERRDPRPDDVTIDILYCGVCHSDIHQARNE
WHNSLFPMVPGHEIIGTVSAVGAKVSGFKVGDRVGVGCMVDSCRECAPCKADLEQYCEDG
ATLTYNGRDRHDHSLTFGGYSERIVVSEAFVLRLPDALDAKSAAPLLCAGITTYSPLRHW
QVGPGSRVAVIGLGGLGHMGLKLAKAMGAEVSLFTRSPGKEDEAKRLGADHVVLSTDEAR
MKAVAGHFNLIIDTVPHPHDLNPYVSTLALDGTLVLVGLLGPIEPVIDSVPLVIGRRAVA
GSAIGGIAETQEMLDFCAAKGVTADVEMLDINNINAAYDRMLKSDVRYRFVIDMATLRGA