Protein Info for Rru_A1497 in Rhodospirillum rubrum S1H

Annotation: Cyclic peptide transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 137 to 162 (26 residues), see Phobius details amino acids 168 to 184 (17 residues), see Phobius details amino acids 248 to 272 (25 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details TIGR01194: cyclic peptide transporter" amino acids 25 to 555 (531 residues), 502.5 bits, see alignment E=7.6e-155 PF00664: ABC_membrane" amino acids 34 to 216 (183 residues), 43.9 bits, see alignment E=3.8e-15 PF00005: ABC_tran" amino acids 372 to 505 (134 residues), 93.1 bits, see alignment E=3.5e-30

Best Hits

KEGG orthology group: K06160, putative ATP-binding cassette transporter (inferred from 100% identity to rru:Rru_A1497)

Predicted SEED Role

"ATP-binding protein syrD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU97 at UniProt or InterPro

Protein Sequence (557 amino acids)

>Rru_A1497 Cyclic peptide transporter (NCBI) (Rhodospirillum rubrum S1H)
MTAPGTAPAPASSSAAAASPLALALRLLRPFWRLVLLSTLMGTLGGIATALLLAVINRAL
RGEGDMVSFAWAFGGLCLAALLGQGAAGLGSAIVGQKVVVAVRRELVAHILTAPIARLER
LRVHRLMATLGGDVDALSGFSLVLSGLGVAVAITCGCLGYLVLLSPPLFLVTLLVLGLGV
GGHARMRRLGQARFAAARAAEDDLQRHYRAITEGAKELRLNRPRRIRLFHADLEATITRI
AKLRLRGLGVFLGANLFGSLALFAVIGGILLMTRAAPEAIGVEDVSGFVLVLLFMKGPMQ
QILGALPSLGRAQIALRRIAELGAAGQEGGDLPGLAPGMGEGAVPMPAEITLEAVSYRFP
ESAAGPGFTLGPLTLTLRRGESVVITGENGCGKTTLIKLILGLYQPTAGRVLLDGRPVRA
GEWDEYRQLFSAVFADYHLFDDGMAEGRQAAEAARLLDAFDLATKTALKDGRFTTTDLSA
GERKRLALILLALEGRPIVVFDEWAAEQDPGFRHRFYHTVLPDLKRQGRTVIVVSHDEGY
FDCADRRIVLKNGKLAG