Protein Info for Rru_A1492 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 7 to 7 (1 residues), see Phobius details amino acids 25 to 25 (1 residues), see Phobius details transmembrane" amino acids 8 to 24 (17 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 373 to 396 (24 residues), see Phobius details amino acids 404 to 421 (18 residues), see Phobius details amino acids 427 to 444 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 241 to 381 (141 residues), 58.1 bits, see alignment E=4.7e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1492)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUA2 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Rru_A1492 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MTLSANDLIFRALLALVVLAPLPLGANRPAAWSALALIAGILLALWSIRTLIGAGTPPPR
LAPLARVALPLLLVLVWGGVQASALVPADWRHPLWAEAASALPGPVVGHLSLDPARSLDG
VMKLLSYGVIFGLACVLGRNRARARLGLRVVAWSATAYAIYGLCMFFAGWERLLWLEKTD
YLGDLTATFVNRNAFGAYAGLGLLCCLALVLSHLRRPARGGMRHHAERLVLGGLPYALGG
FLLTMALLFSHSRGALLATACAVLVLILALGTARVLSWRIASAALLVIGIGGATLSLTSD
QVTLERLLDQTELSGDRGQLLRLGGEMASDASAGGFGIGAFAPAFRLYRDASLPRPVIYD
FAHNIYLEAIIELGLPAALLLGLSLTMVLTSCALGLRRRRRDQIYPALALAAASLLLVHG
LADFSISMPAIAATLALLLGLGFAQSRSTRPATATDEEGDAEAAHGVG