Protein Info for Rru_A1482 in Rhodospirillum rubrum S1H

Annotation: Undecaprenyl-phosphategalactosephosphotransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 27 to 452 (426 residues), 357.9 bits, see alignment E=5.4e-111 PF13727: CoA_binding_3" amino acids 71 to 140 (70 residues), 31.4 bits, see alignment E=1.9e-11 PF02397: Bac_transf" amino acids 265 to 445 (181 residues), 209.2 bits, see alignment E=3.6e-66

Best Hits

KEGG orthology group: K00996, undecaprenyl-phosphate galactose phosphotransferase [EC: 2.7.8.6] (inferred from 100% identity to rru:Rru_A1482)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUB2 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Rru_A1482 Undecaprenyl-phosphategalactosephosphotransferase (NCBI) (Rhodospirillum rubrum S1H)
MMDGSASGYRRIGEGRVAVAMIGVRALDLMILALGCLIGYGLRHGTPMMPEPYWAALIIA
AFVFQGAGGGLGLYSRRRPGPLPSQLAAVLLSLVATFLVLFALAYLGKVSQEFSRSWAVT
WFFIAVCAMTALRVGVARVGTLAPLWRARAVLLAADGDTGLLARLAADEGRRVDIVACLD
PVRDGARLARHCEEAKADVVFVAVPPAGIDDALRRRLRDLPLRICLLIDPPIADHPLVGP
PEIIAGAISVELYPPVLEGGGALIKRLEDLVLGALLVVVLSPLMVLVALVVRLEGAGPVL
FCQKRFGFRGEVFTIFKFRTLVEAAGETQVGRDDPRVTRVGRLLRRLSLDELPQLFNVLK
GDMSLVGPRPHALAHDEDFAATVDIYAQRRKMKPGMTGWAQVHGCRGEIRSPQDLERRVA
YDLAYLDHWSLGLDLWILALTPLRLIRDPNAY