Protein Info for Rru_A1472 in Rhodospirillum rubrum S1H
Annotation: Acetate CoA-transferase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to ATOD_ECOLI: Acetate CoA-transferase subunit alpha (atoD) from Escherichia coli (strain K12)
KEGG orthology group: K01034, acetate CoA-transferase alpha subunit [EC: 2.8.3.8] (inferred from 100% identity to rru:Rru_A1472)MetaCyc: 53% identical to acetyl-CoA:acetoacetyl-CoA transferase subunit alpha (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Acetyl-CoA:acetoacetyl-CoA transferase, alpha subunit (EC 2.8.3.8)" in subsystem Acetyl-CoA fermentation to Butyrate (EC 2.8.3.8)
MetaCyc Pathways
- acetyl-CoA fermentation to butanoate (6/7 steps found)
- acetoacetate degradation (to acetyl CoA) (2/2 steps found)
- pyruvate fermentation to acetone (4/5 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (7/10 steps found)
- L-glutamate degradation XI (reductive Stickland reaction) (4/7 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (11/17 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (8/13 steps found)
- gallate degradation III (anaerobic) (5/11 steps found)
- 4-aminobutanoate degradation V (2/7 steps found)
- succinate fermentation to butanoate (2/7 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.8.3.8
Use Curated BLAST to search for 2.8.3.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RUC2 at UniProt or InterPro
Protein Sequence (220 amino acids)
>Rru_A1472 Acetate CoA-transferase (NCBI) (Rhodospirillum rubrum S1H) MSKITPLEKAVARIPDGAVLMIGGFMGAGTPHRLMDELVRQGKRDLTVIANDTARPTVGI GKLIDAGLVSKVIASHIGTNPQTQKLMIAGTIEVALIPQGTLAEQIRAGGFGLGGVITPT GVGTLAAEGMQTIELAGKSYLIALPLRADFALINAKAADYRGNLRYAMTSRNFNPLMAMA AETVIAEAEDFVPIGAIEPDAVATPHVLVDVLIAKERSHG