Protein Info for Rru_A1463 in Rhodospirillum rubrum S1H
Annotation: Sulfotransferase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01014, aryl sulfotransferase [EC: 2.8.2.1] (inferred from 100% identity to rru:Rru_A1463)Predicted SEED Role
"aryl sulfotransferase"
MetaCyc Pathways
- serotonin degradation (5/7 steps found)
- dopamine degradation (2/5 steps found)
- melatonin degradation I (2/5 steps found)
- superpathway of melatonin degradation (2/11 steps found)
- thyroid hormone metabolism II (via conjugation and/or degradation) (2/15 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.8.2.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RUD1 at UniProt or InterPro
Protein Sequence (280 amino acids)
>Rru_A1463 Sulfotransferase (NCBI) (Rhodospirillum rubrum S1H) MSFVWLASYPKSGNTWMRLMLQSLMQGGEPVDLSRPITPGLPLRSRDTLGRLLGADCGEL SAEEIDRLRPWTYIKAAGLLPGPSFHKTHERWRRTAWNEPILPPEASCGAVYILRDPRDI ALSLAHYTAVTVDEAIAVMADADHTLAEAGDRYCVLYRQPLGTWSQHVLSWLEDADPPPL VLRYEDMIDDPLAALTGVCAHIGLTAPAAALRAATRSCAFDVLRRAEQDHGFTEAVPGRA FFRRGLAGGWRDTLSPAQRQRIEDDHRAVMSRFGYLPPSR