Protein Info for Rru_A1444 in Rhodospirillum rubrum S1H

Annotation: Ribonucleoside-diphosphate reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00317: Ribonuc_red_lgN
  • amino acids 52 to 116 (65 residues), 60.5 bits, E=1.3e-20
• PF02867: Ribonuc_red_lgC
  • amino acids 120 to 439 (320 residues), 257.7 bits, E=2.2e-80
  • amino acids 447 to 593 (147 residues), 138.2 bits, E=3.7e-44

Best Hits

Swiss-Prot: 45% identical to RIR1_FRG3G: Putative ribonucleoside-diphosphate reductase large subunit (FV3-038R) from Frog virus 3 (isolate Goorha)

KEGG orthology group: K00525, ribonucleoside-diphosphate reductase alpha chain [EC: 1.17.4.1] (inferred from 100% identity to rru:Rru_A1444)

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), alpha subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (9/9 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (11/14 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

See Q2RUF0 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Rru_A1444 Ribonucleoside-diphosphate reductase (NCBI) (Rhodospirillum rubrum S1H)
MSSAPAFDFDRQGNLVASPPRQSHQPTSQIRRRPHPPETSEIRLERSRDDKLNAFGKAML
GDRYLLPGEGIQDMFARVSCAFADNAAHAQRLYDAMSKLWFMPATPILSNGGTQRGLPIS
CFLNTVPDSLEGIVAIWNENVDLASNGGGIGTYWGGVRSIGEAVKGNGATSGIIPFIRVM
DSLTLAISQGSLRRGSAAVYLDIHHPEIEEFLEIRKASGDFNRKSLNLHHAINITDDFME
AVRDDRQFALKSPKSGEVLRSVGARQLWQKILETRLQTGEPYLLFTDTVNRALPKHQRDL
GLRVSSSNLCAEITLPTGRDHRGQERTAVCCLSSLNIETWDEWENAPGFIEDVLRFLDNV
LSHFIETAPDGMERAAYAAMRERSVGLGVMGFHSFLQARGIPFESALAKSWNLRLFRKIR
RDADAASVDLADERGACPDAAERGMKARFSAKLAIAPTASISIICGGTSACVEPIPANVY
THKTLSGSFSVRNPHLARRLADKGLDTAETWQSIIEHEGSVQHLEGLSDDEKLVFRTAFE
IDQRWIIDLAADRAPFICQSQSINLYLPADADKWDLHMLHWTAWRRGLKSLYYCRSKSVQ
RAAFVGREKPSGETSSAPRADYDECLACQ