Protein Info for Rru_A1434 in Rhodospirillum rubrum S1H

Annotation: Quinolinate synthetase A (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 50 to 341 (292 residues), 303.9 bits, see alignment E=6e-95 PF02445: NadA" amino acids 51 to 339 (289 residues), 367.7 bits, see alignment E=2.1e-114

Best Hits

Swiss-Prot: 66% identical to NADA1_RHILO: Quinolinate synthase A 1 (nadA1) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to rru:Rru_A1434)

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUG0 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Rru_A1434 Quinolinate synthetase A (NCBI) (Rhodospirillum rubrum S1H)
MPFASDRAATTLADLSWSAEVERESAALYEKVARVVPPVEWRVFAPLILAINALKAERGA
VILAHSYQTPEIYHCVADIVGDSLQLARQAAEVEADILVQCGVHFMAETAKLLNPTKRVL
CPDPGAGCSLAASITAADVRALRRRHPGVPIVAYVNTSATVKAEVDICCTSSNALAVVES
LGAPRVILVPDRYLATYVASQTTVEIIAWPGACEVHERFTGEDIARYREGDGDLRIIAHP
ECPPDVIAASDFTGSTSAMIAWVRANRPRRVALITECSMADNLAAEMPETDFVRPCNLCP
HMKKITLTKILACLRTLGGEITIDPAVAEGARRSVRRMIDLGS