Protein Info for Rru_A1426 in Rhodospirillum rubrum S1H

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 59 to 163 (105 residues), 43 bits, E=1.8e-14
• PF12837: Fer4_6
  • amino acids 89 to 111 (23 residues), 26.3 bits, see alignment (E = 2.1e-09)
• PF00037: Fer4
  • amino acids 90 to 112 (23 residues), 34.3 bits, see alignment (E = 5.9e-12)
• PF12838: Fer4_7
  • amino acids 95 to 158 (64 residues), 27.8 bits, E=1.1e-09

Best Hits

Swiss-Prot: 100% identical to COOF_RHORU: Iron-sulfur protein (cooF) from Rhodospirillum rubrum

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1426)

MetaCyc: 100% identical to CooF ferredoxin-type iron-sulfur protein (Rhodospirillum rubrum)
1.2.7.4,2.3.3.M4,2.3.3.M4,2.3.3.M5 [EC: 1.2.7.4, 2.3.3.M4, 2.3.3.M5]

Predicted SEED Role

"CO dehydrogenase iron-sulfur protein CooF (EC 1.2.99.2)" in subsystem Carbon monoxide induced hydrogenase (EC 1.2.99.2)

MetaCyc Pathways

• hydrogen production VI (2/2 steps found)
• carbon tetrachloride degradation II (4/6 steps found)
• methanogenesis from acetate (3/6 steps found)
• reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• superpathway of methanogenesis (3/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.7.4 or 1.2.99.2 or 2.3.3.M4 or 2.3.3.M5

Sequence Analysis Tools

See Q2RUG8 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Rru_A1426 4Fe-4S ferredoxin, iron-sulfur binding (NCBI) (Rhodospirillum rubrum S1H)
MPPIKENVIIYANPDHCLSCHSCELACAVAHSGGHDMIEAIAANLPLHARNKVVSVDGTA
MPMQCRQCEDAPCTFACPTGACRQADGQVQIVEQHCIGCKLCVMVCPFGAITVRSETVVE
QGACTNRGVAKKCDLCVDWRASTGKTAPACVEACPTKAIRMVDLDAYRIALREARAREIA
KSHRHMRVQF