Protein Info for Rru_A1422 in Rhodospirillum rubrum S1H

Annotation: NADH ubiquinone oxidoreductase, 20 kDa subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 47% identical to Y516_METJA: Uncharacterized protein MJ0516 (MJ0516) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1422)

MetaCyc: 100% identical to CooL subunit (Rhodospirillum rubrum)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Carbon monoxide-induced hydrogenase small subunit CooL" in subsystem Carbon monoxide induced hydrogenase

MetaCyc Pathways

hydrogen production VI (2/2 steps found)
hydrogen production III (1/1 steps found)
hydrogen production VIII (1/1 steps found)
superpathway of hydrogen production (1/2 steps found)
superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)
superpathway of photosynthetic hydrogen production (3/6 steps found)
L-glutamate degradation VII (to butanoate) (6/12 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUH2 at UniProt or InterPro

Protein Sequence (142 amino acids)

>Rru_A1422 NADH ubiquinone oxidoreductase, 20 kDa subunit (NCBI) (Rhodospirillum rubrum S1H)
MNFLSRMSKKSPWLYRINAGSCNGCDVELATTACIPRYDVERLGCQYCGSPKHADIVLVT
GPLTARVKDKVLRVYEEIPDPKVTVAIGVCPISGGVFRESYSIVGPIDRYLPVDVNVPGC
PPRPQAIIEGIAKAIEIWAGRI