Protein Info for Rru_A1421 in Rhodospirillum rubrum S1H

Annotation: Respiratory-chain NADH dehydrogenase, subunit 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 236 to 260 (25 residues), see Phobius details amino acids 266 to 289 (24 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details PF00146: NADHdh" amino acids 24 to 319 (296 residues), 212.1 bits, see alignment E=6.1e-67

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1421)

MetaCyc: 100% identical to CooK subunit (Rhodospirillum rubrum)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Carbon monoxide-induced hydrogenase proton translocating subunit CooK" in subsystem Carbon monoxide induced hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUH3 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Rru_A1421 Respiratory-chain NADH dehydrogenase, subunit 1 (NCBI) (Rhodospirillum rubrum S1H)
MTDSLVQTLSVLFAAVVFPGGIFAITLGLALKGFDRRVFARLQRRVGAPLLQPFYDVLKL
MTKRTLVPENANLVVFLMVPLLGLASMGVAAAMIPIPGLYDPSPAFGDLLVLFYLLSVPA
VMLMLAGSASGSPFGGIGFSREMAIMLAYEGPILLVIVSVALKTGAALGQPICLSLSEIV
RYQQAHGAYLFDPWMWPAVLTYIAFIPANLGISPFDIPEAESEVLEGPLIEYSGVALGLL
KLTSAVKSVVVIGLGIVLFFPNGPEGLFGLVVFALKCLVITVCGVSVLRAAVGRMRIDQA
VIFYLKWPELLGIASLALVAMNL