Protein Info for Rru_A1413 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF224, cysteine-rich region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details PF02754: CCG" amino acids 12 to 92 (81 residues), 50.1 bits, see alignment E=1.2e-17 amino acids 140 to 225 (86 residues), 56.1 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 43% identical to LUTA_GEOTN: Lactate utilization protein A (lutA) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: K00104, glycolate oxidase [EC: 1.1.3.15] (inferred from 100% identity to rru:Rru_A1413)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUI1 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Rru_A1413 Protein of unknown function DUF224, cysteine-rich region (NCBI) (Rhodospirillum rubrum S1H)
MSRDVPEKPASVYFFATCLVDLFYPEAGLAGMTLLERQGIRVIFPPGQTCCGQPMRNNGW
LDEARAIARQQIKTFPKPIPIVVPSGSCAGMMHRHYPELFAGQPDEAEARAFAARVYELT
WFLVHVCKLSLTDGGPPVTVAFHASCHSQREMGVRGEPESLLAGLSNVTLAKLERPNECC
GFGGAFSVRQPEISAAMVADKIDDLSKSGASEVLSGDCGCLMNIKGALEKAGRPQKARHI
AEFLVERGR