Protein Info for Rru_A1409 in Rhodospirillum rubrum S1H

Annotation: L-lactate permease (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 116 to 184 (69 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 403 to 433 (31 residues), see Phobius details amino acids 437 to 454 (18 residues), see Phobius details amino acids 499 to 512 (14 residues), see Phobius details amino acids 525 to 546 (22 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 6 to 540 (535 residues), 730.4 bits, see alignment E=7.2e-224 PF02652: Lactate_perm" amino acids 16 to 538 (523 residues), 713.3 bits, see alignment E=1e-218

Best Hits

Swiss-Prot: 68% identical to LLDP_ECOLI: L-lactate permease (lldP) from Escherichia coli (strain K12)

KEGG orthology group: K00427, L-lactate permease (inferred from 100% identity to rru:Rru_A1409)

MetaCyc: 68% identical to lactate/glycolate:H+ symporter LldP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-104; TRANS-RXN-105; TRANS-RXN0-515; TRANS-RXN0-622

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUI5 at UniProt or InterPro

Protein Sequence (547 amino acids)

>Rru_A1409 L-lactate permease (NCBI) (Rhodospirillum rubrum S1H)
MQPWTQVYDPFGNIWLSSLVAVIPIIFFFVALAVFRMKGALAGTITVLLALAVAVFFYQM
PVASALMSGIQGFLFGLWPIAWIIIAAVFLYKVTVKTGQFDIIRASVISITEDQRLQMLM
IGFSFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGAVGIPIIVA
GQVSGVDTFKIGAMAGRQLPFLAVFVPFWLIFIMDGWKGVKETWPAVLVAGGSFALCVFL
TSNYIGPELPDIISALVSLIAITVFLKYWKPKRIFRFKDTTEAERHAHDYSLGQILRAWS
PFLILTLMVTLWSLKPFKALFAKGAELAFTNLTWEVPFLHNLIAKVPPIVPTIKEVPAVY
TLNLISATGTAILIAAIIAIVALSMRPTDGLKTLGETFRELKLPIYTIGTVLAFAYVANA
SGLSTTLALLLAGAGDSFPFFSPVLGWLGVFLTGSDTSSNALFGALQATTAHQIGVSDVL
LVAANTTGGVTGKMISPQSIAVACAAVGLIGHEANLFRFTLKHSLFFLLIICVMTTLQAY
VFPWMIP