Protein Info for Rru_A1393 in Rhodospirillum rubrum S1H

Annotation: Nitrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03139: AnfG_VnfG
  • amino acids 6 to 116 (111 residues), 183 bits, E=7.5e-59
• TIGR02929: Fe-only nitrogenase, delta subunit
  • amino acids 8 to 116 (109 residues), 210.3 bits, E=2.1e-67

Best Hits

Swiss-Prot: 100% identical to ANFG_RHORU: Nitrogenase iron-iron protein delta chain (anfG) from Rhodospirillum rubrum

KEGG orthology group: K00531, nitrogenase [EC: 1.18.6.1] (inferred from 100% identity to rru:Rru_A1393)

MetaCyc: 67% identical to dinitrogenase 3 subunit delta (Azotobacter vinelandii)
Nitrogenase (flavodoxin). [EC: 1.19.6.1]

Predicted SEED Role

"Nitrogenase (iron-iron) delta chain (EC 1.18.6.1)" in subsystem Nitrogen fixation (EC 1.18.6.1)

MetaCyc Pathways

• nitrogen fixation I (ferredoxin) (1/1 steps found)
• nitrogen fixation II (flavodoxin) (1/1 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1 or 1.19.6.1

Sequence Analysis Tools

See Q2RUK1 at UniProt or InterPro

Protein Sequence (116 amino acids)

>Rru_A1393 Nitrogenase (NCBI) (Rhodospirillum rubrum S1H)
MDDLMKDRIDLLIDYIMKHCLWQFHSRSWDRKRQNEGILTKTTQLLCDEPVDLGTPADKC
YWVDAVCLADAYKSRYPWLKTMDKDDIKALMGALHERLDHLTITGSLNLELTDQHY