Protein Info for Rru_A1385 in Rhodospirillum rubrum S1H

Annotation: Two Component, Sigma54 Specific, Transcriptional Regulator, Fis family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 107.3 bits, see alignment E=1.9e-34 PF00158: Sigma54_activat" amino acids 147 to 312 (166 residues), 243.4 bits, see alignment E=4.3e-76 PF14532: Sigma54_activ_2" amino acids 150 to 314 (165 residues), 58.3 bits, see alignment E=4.5e-19 PF00004: AAA" amino acids 170 to 302 (133 residues), 21.9 bits, see alignment E=8.3e-08 PF07728: AAA_5" amino acids 170 to 288 (119 residues), 28.3 bits, see alignment E=6.2e-10 PF25601: AAA_lid_14" amino acids 318 to 392 (75 residues), 89.4 bits, see alignment E=4.4e-29 PF02954: HTH_8" amino acids 419 to 457 (39 residues), 45 bits, see alignment 2.8e-15

Best Hits

Swiss-Prot: 57% identical to ATOC_ECOLI: Regulatory protein AtoC (atoC) from Escherichia coli (strain K12)

KEGG orthology group: K07714, two-component system, NtrC family, response regulator AtoC (inferred from 100% identity to rru:Rru_A1385)

Predicted SEED Role

"Acetoacetate metabolism regulatory protein AtoC" in subsystem Acetyl-CoA fermentation to Butyrate or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUK9 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Rru_A1385 Two Component, Sigma54 Specific, Transcriptional Regulator, Fis family (NCBI) (Rhodospirillum rubrum S1H)
MLAPAQTVLIVDDDEAIRQMLSAFLSKEGLRVVTARDGLEAIEVFRLQRTDVVLLDIRMP
RMNGLEAAKAILEMDRGTAVILMTAFAEVCTAVQAIKDGAFDYVIKPFDLEEIRLLVRRA
LEIRSMRADIVSLRRELSERYGAEGILTDNPKMMDLRQTIAKVARSQATVLIQGESGTGK
ELVAASVHYGSPRATGPFIRVNCAAIPEGLLESEFFGHEKGAFTGAATRRRGRFEQAEHG
TLFLDEIGEISPALQVKLLRVLQEREYERVGGSEPIPADVRIVAATNRDLEAMIREGTFR
QDLFFRLNVVALKTIPLRDRPEDIRLLADHFLGRFAADNNVVIRGFDPAALDCMLAYPWP
GNVRELVNAVERAVVMSTGNVILRDDLPENIICGERAAFVSELLPDGEAIRPLREMASEF
ETRVIRLALARNGGNRARTAIQLGISRRALLYKLQEYAIT