Protein Info for Rru_A1384 in Rhodospirillum rubrum S1H

Annotation: Multi-sensor Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details PF00989: PAS" amino acids 274 to 380 (107 residues), 43.5 bits, see alignment E=7.3e-15 TIGR00229: PAS domain S-box protein" amino acids 275 to 385 (111 residues), 34.4 bits, see alignment E=1e-12 PF08448: PAS_4" amino acids 278 to 385 (108 residues), 32 bits, see alignment E=3.2e-11 PF13426: PAS_9" amino acids 282 to 382 (101 residues), 32.6 bits, see alignment E=2.1e-11 PF00512: HisKA" amino acids 399 to 462 (64 residues), 54.4 bits, see alignment E=2.6e-18 PF02518: HATPase_c" amino acids 503 to 607 (105 residues), 92.9 bits, see alignment E=4.5e-30

Best Hits

KEGG orthology group: K07710, two-component system, NtrC family, sensor histidine kinase AtoS [EC: 2.7.13.3] (inferred from 100% identity to rru:Rru_A1384)

Predicted SEED Role

"Sensory histidine kinase AtoS" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUL0 at UniProt or InterPro

Protein Sequence (617 amino acids)

>Rru_A1384 Multi-sensor Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MRLSDLSRILPLRSLRHRLMLTSLIVVALPIAIVGIVFEHEGRQALLHEKQSKLFGLTQI
LDAELGPGFDSLLADLPSGWTDRAAAIAHLSAKLTLQTDRIAGIGDGIAVGYYSKRLDAI
ITYGPSASYAKTIGVSITADHPGRAVMDSAKPRVEFGTLVRGQIMNAMLPIIRNDEVIGY
IWANEFIEAIENQQNVFHRAVLFVSLAGIGIAFFVVNSMSRRLSQEVGVIVDGLAVMEND
LRRPLPPLRDELGNIVDAINAMAKALLDARSLTENILASVADGIVAVDLKGTITAFNPAA
EQMYSMSADAVIGKPYHALFISGTDMVSVLLDTLETGCTHIGVTPDLPNLDGTLKISASS
SVLRDGEGQPIGAVVVLKDVSERDRLMVQVMRADRLAALGELTAGIAHEIRNPLTSIRGF
VQYLMECASPKEWQHYGPLIIRQVDSLNHIITELLAFGRPRAPRIDKVHLDQIAQEMAFL
ARGKSEARIEMDLEGEVPAIEADGESLKQALLNLIINAMQAISKDGSVTVAVRRLGDDHV
MVKVSDDGIGLAPDYLDKVFDPFFSTKPAGTGLGLAVVHRIVDAHQGVITLDSRLGEGTV
VTIRLPVVRSKQESPPC