Protein Info for Rru_A1381 in Rhodospirillum rubrum S1H

Annotation: Short chain fatty acid transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 368 to 393 (26 residues), see Phobius details amino acids 454 to 477 (24 residues), see Phobius details PF02667: SCFA_trans" amino acids 26 to 474 (449 residues), 315.2 bits, see alignment E=4.3e-98

Best Hits

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 100% identity to rru:Rru_A1381)

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUL3 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Rru_A1381 Short chain fatty acid transporter (NCBI) (Rhodospirillum rubrum S1H)
MSPNVMETTADQESRGKTGVESQGRLAHMAFEFTRIAEKWFPDAFVFVVLTTLVVTAADL
AIGASPLQIAKGFGAGFWTLIPFTMQMAMVAITGYVVATSPPCTRLITKLAAFPSTPAGA
VAWVAFISMAASYLNWALSLVLGGLLVRALARRVDLKMDYRAAGAAAYMGLGSTWALGLS
SSSAMLQANPLSLPKSISDISGVIPLSQTIFLWQSVVLYLSLMTLAVVVFYFAAPRGKHV
RTAQDMGVDVSIEPEPAQKPKRPGEWLEFTPVLPILVVILSVGYFWEQFSSQGVLVTVSS
LNNYNFAFLMLGLLLHRNIRSFLTAVTRAVPTSAGVLIQFPFYGAIAAMLTGVLGSDGIS
ISHHISELFVSIATTNSFPIVIGIYSAILGFLIPSGGGKWIIEAPYVLQAAKDIHAHMGW
AVQVYNAAEALPNLINPFWMLPLLGILKLQARDIVGFCFTQLIFSAPVVMLLLWVFAQTL
AP