Protein Info for Rru_A1360 in Rhodospirillum rubrum S1H

Annotation: Dak phosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02365: dihydroxyacetone kinase, L subunit
  • amino acids 14 to 204 (191 residues), 175 bits, E=7.7e-56
• PF02734: Dak2
  • amino acids 35 to 205 (171 residues), 161.8 bits, E=7.8e-52

Best Hits

Swiss-Prot: 36% identical to DHAL_ECOLI: PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL (dhaL) from Escherichia coli (strain K12)

KEGG orthology group: K05879, dihydroxyacetone kinase, C-terminal domain [EC: 2.7.1.-] (inferred from 100% identity to rru:Rru_A1360)

MetaCyc: 36% identical to dihydroxyacetone kinase subunit L (Escherichia coli K-12 substr. MG1655)
Phosphoenolpyruvate--glycerone phosphotransferase. [EC: 2.7.1.121]

Predicted SEED Role

"Putative dihydroxyacetone kinase (EC 2.7.1.29), ADP-binding subunit" in subsystem Dihydroxyacetone kinases (EC 2.7.1.29)

MetaCyc Pathways

• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• glycerol degradation to butanol (12/16 steps found)
• glycerol degradation II (1/2 steps found)
• glycerol degradation V (1/2 steps found)
• superpathway of glycerol degradation to 1,3-propanediol (1/4 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.29

Use Curated BLAST to search for 2.7.1.- or 2.7.1.121 or 2.7.1.29

Sequence Analysis Tools

See Q2RUN4 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Rru_A1360 Dak phosphatase (NCBI) (Rhodospirillum rubrum S1H)
MHDTLSASDLRQMFLGVCDTMLANIDRLTKADQLIGDGDHGIGMRRGFTAVRAYLETATE
ETVGAVFKGVGTALMSHTGGAAGAIFGTLFRAGATLDTPTLTGEGYARFLEDALAAVQKR
GGCTTGGKTLIDALAPAALAARAGVSAGAPLPEVLAAAAEAAEQGMEATKAMIATTGKAR
TLGERSLGHPDPGAISLAIVLAAMSSHVPAPAGAA