Protein Info for Rru_A1360 in Rhodospirillum rubrum S1H

Annotation: Dak phosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR02365: dihydroxyacetone kinase, L subunit" amino acids 14 to 204 (191 residues), 175 bits, see alignment E=7.7e-56 PF02734: Dak2" amino acids 35 to 205 (171 residues), 163.7 bits, see alignment E=2e-52

Best Hits

Swiss-Prot: 36% identical to DHAL_ECOLI: PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL (dhaL) from Escherichia coli (strain K12)

KEGG orthology group: K05879, dihydroxyacetone kinase, C-terminal domain [EC: 2.7.1.-] (inferred from 100% identity to rru:Rru_A1360)

MetaCyc: 36% identical to dihydroxyacetone kinase subunit L (Escherichia coli K-12 substr. MG1655)
Phosphoenolpyruvate--glycerone phosphotransferase. [EC: 2.7.1.121]

Predicted SEED Role

"Putative dihydroxyacetone kinase (EC 2.7.1.29), ADP-binding subunit" in subsystem Dihydroxyacetone kinases (EC 2.7.1.29)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.29

Use Curated BLAST to search for 2.7.1.- or 2.7.1.121 or 2.7.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUN4 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Rru_A1360 Dak phosphatase (NCBI) (Rhodospirillum rubrum S1H)
MHDTLSASDLRQMFLGVCDTMLANIDRLTKADQLIGDGDHGIGMRRGFTAVRAYLETATE
ETVGAVFKGVGTALMSHTGGAAGAIFGTLFRAGATLDTPTLTGEGYARFLEDALAAVQKR
GGCTTGGKTLIDALAPAALAARAGVSAGAPLPEVLAAAAEAAEQGMEATKAMIATTGKAR
TLGERSLGHPDPGAISLAIVLAAMSSHVPAPAGAA