Protein Info for Rru_A1358 in Rhodospirillum rubrum S1H

Annotation: Triosephosphate isomerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00121: TIM
  • amino acids 6 to 246 (241 residues), 238.2 bits, E=5.1e-75

Best Hits

Swiss-Prot: 46% identical to ERYH_RHILO: L-erythrulose-1-phosphate isomerase (eryH) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 100% identity to rru:Rru_A1358)

MetaCyc: 46% identical to L-erythrulose 1-phosphate isomerase (Mycolicibacterium smegmatis)
RXN-17772 [EC: 5.3.1.33]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• Calvin-Benson-Bassham cycle (12/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycolysis IV (9/10 steps found)
• gluconeogenesis III (10/12 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• oxygenic photosynthesis (13/17 steps found)
• gluconeogenesis I (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• glycerol degradation to butanol (12/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• L-threitol degradation (1/4 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
• D-apionate degradation I (xylose isomerase family decarboxylase) (1/5 steps found)
• D-apionate degradation II (RLP decarboxylase) (1/5 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• erythritol degradation I (1/6 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.1

Use Curated BLAST to search for 5.3.1.1 or 5.3.1.33

Sequence Analysis Tools

See Q2RUN6 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Rru_A1358 Triosephosphate isomerase (NCBI) (Rhodospirillum rubrum S1H)
MNARLWIGTSWKMHKTIAEAEAYVGELTASPLLDRVEAFIVPPFTALAAVHRALGDAPVH
LGAQTMHWQDEGAQTGEISPLMLRDCGVGIVELGHSERRASHGETDATVNAKVASALRHG
LRPLICVGDQGDDLDAGASIETVLRQVKLAIKGIDTASLGRALIAYEPVWAIGEAGRPAE
PAHVAEVHGALRAMLGQRGLAALPLLYGGSVDRANAGALTALANVDGLFVGRAAWTARGF
EEVIEAALHGAKDRAGLA