Protein Info for Rru_A1329 in Rhodospirillum rubrum S1H

Annotation: transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 29 to 47 (19 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details PF03817: MadL" amino acids 1 to 117 (117 residues), 161.6 bits, see alignment E=3.4e-52 TIGR00807: malonate transporter, MadL subunit" amino acids 1 to 116 (116 residues), 137.4 bits, see alignment E=1.6e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1329)

Predicted SEED Role

"Malonate transporter, MadL subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUR5 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Rru_A1329 transporter (NCBI) (Rhodospirillum rubrum S1H)
MVIYGLFLMGLCMLIGNFVGNLFGAMLGISANIGGVGIAMVLLVVISQRLMDKKKLSEAA
QAGIGFWSAMYIPIVVAMAAQQNVVSAMNGGALAFVAGLGAVFVGFLLIKPISALGGKSD
VAEDSVKGH