Protein Info for Rru_A1325 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR03134: biotin-independent malonate decarboxylase, gamma subunit" amino acids 10 to 285 (276 residues), 323 bits, see alignment E=7.3e-101 PF01039: Carboxyl_trans" amino acids 36 to 164 (129 residues), 30.3 bits, see alignment E=2.7e-11 PF03255: ACCA" amino acids 42 to 201 (160 residues), 27.7 bits, see alignment E=2.3e-10 PF06833: MdcE" amino acids 77 to 278 (202 residues), 124.5 bits, see alignment E=7.2e-40

Best Hits

Swiss-Prot: 69% identical to MADD_MALRU: Malonyl-S-ACP:biotin-protein carboxyltransferase MADD (madD) from Malonomonas rubra

KEGG orthology group: K13933, malonate decarboxylase gamma subunit (inferred from 100% identity to rru:Rru_A1325)

MetaCyc: 69% identical to malonyl-S-ACP:biotin-protein carboxyltransferase beta subunit (Malonomonas rubra)
RXN-9774 [EC: 7.2.4.4]; Malonyl-S-ACP:biotin-protein carboxyltransferase. [EC: 7.2.4.4, 2.1.3.10]

Predicted SEED Role

"Malonate decarboxylase gamma subunit" in subsystem Malonate decarboxylase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.10 or 7.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUR9 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Rru_A1325 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MDVTETMMGKGREAIDLIVDPQGFTENTVGSKTFDDPEFGPGAVVGTGLLNGQTCTIIAS
DGNAFNEKFPVVYAGIIGMEEGYKMAQAVYASLEADADKPIAQKRPLVLIVDTPGNGPGK
TEEIFGMNKATGAYQLALAEARLAGHPIVAMVIGRAISGAFLCHGLQADNILSLDANFGT
MIHVMPLTSVSRIIRKDLETLQELSKGNPVFAAGPRFFFALGGVEELVTAIDGMRPAIIA
HIESIRQAKLAGKQDSLGPWGRGALGAERGGRVVRPELIALMNAEFAAVASQYAPAR