Protein Info for Rru_A1323 in Rhodospirillum rubrum S1H

Annotation: Malonate decarboxylase delta subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03130: malonate decarboxylase acyl carrier protein
  • amino acids 4 to 101 (98 residues), 124.9 bits, E=4.7e-41
• PF06857: ACP
  • amino acids 21 to 102 (82 residues), 82 bits, E=1.5e-27

Best Hits

Swiss-Prot: 52% identical to MDCC_MALRU: Malonate decarboxylase acyl carrier protein (mdcC) from Malonomonas rubra

KEGG orthology group: K13931, malonate decarboxylase delta subunit (inferred from 100% identity to rru:Rru_A1323)

MetaCyc: 52% identical to malonate decarboxylase acyl-carrier protein subunit (Malonomonas rubra)
RXN-9774 [EC: 7.2.4.4]

Predicted SEED Role

"Malonate decarboxylase delta subunit" in subsystem Malonate decarboxylase

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.4.4

Sequence Analysis Tools

See Q2RUS1 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Rru_A1323 Malonate decarboxylase delta subunit (NCBI) (Rhodospirillum rubrum S1H)
MALNTLEFDIKHDAGTPVLKAPVHIGVVGSGDMEVLMEPKALGGAVSVRIVTPVTGFDAL
WKRVLEAFVTESALADVRVEINDNNATPAVVLLRLRQALAEAAGK