Protein Info for Rru_A1320 in Rhodospirillum rubrum S1H

Annotation: Na+-transporting methylmalonyl-CoA/oxaloacetate decarboxylase, beta subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 51 to 78 (28 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 235 to 262 (28 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 308 to 334 (27 residues), see Phobius details amino acids 375 to 401 (27 residues), see Phobius details TIGR03136: Na+-transporting malonate decarboxylase, carboxybiotin decarboxylase subunit" amino acids 3 to 401 (399 residues), 808 bits, see alignment E=9.2e-248 PF03977: OAD_beta" amino acids 27 to 397 (371 residues), 363.4 bits, see alignment E=6.1e-113

Best Hits

Swiss-Prot: 69% identical to MADB_MALRU: Carboxybiotin decarboxylase (madB) from Malonomonas rubra

KEGG orthology group: K01572, oxaloacetate decarboxylase, beta subunit [EC: 4.1.1.3] (inferred from 100% identity to rru:Rru_A1320)

MetaCyc: 69% identical to carboxybiotin decarboxylase (Malonomonas rubra)
RXN-9774 [EC: 7.2.4.4]; RXN-9777 [EC: 7.2.4.4, 7.2.4.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.3 or 7.2.4.1 or 7.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUS4 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Rru_A1320 Na+-transporting methylmalonyl-CoA/oxaloacetate decarboxylase, beta subunit (NCBI) (Rhodospirillum rubrum S1H)
MFDQILTVFPGIGTLFVQEPVIAISRLGLMGLGFFLAYLGFKRTLEPLIMVPMGLGMMAV
NAGVMFLEAGQIGTLIIAPMVSDTEGLINILQIDFLQPVYNFTFTNSLVACLLFMGIGTM
ADISFILARPWASMTVALFAELGTFATLVIGYYCGLTPGQAAAVGSIGGADGPMVLFASL
VMAKDLFVPISIIAYLYLSLCYAGYPYLVKWLIPEKYRGLEVEFEFPDVSQEAKFVFTIV
AAGLLCFLLPVAAPLILSFFLGVAIKEAEIEPYQQLLEKTITYGATLFLGLVLGVLCEAS
TLLDPRVAILLVLGITALAISGLGGIAGGWFMWWWSKGKFNPVIGIAGVSCMPSTAKIAQ
QIAFEASPYAMIMPLAMGAQICGVIVSAIAVGVFASTIGLVGG