Protein Info for Rru_A1313 in Rhodospirillum rubrum S1H

Annotation: Membrane protein involved in aromatic hydrocarbon degradation (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF03349: Toluene_X" amino acids 20 to 429 (410 residues), 349.4 bits, see alignment E=2.2e-108

Best Hits

KEGG orthology group: K06076, long-chain fatty acid transport protein (inferred from 100% identity to rru:Rru_A1313)

Predicted SEED Role

"Long-chain fatty acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUT1 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Rru_A1313 Membrane protein involved in aromatic hydrocarbon degradation (NCBI) (Rhodospirillum rubrum S1H)
MTIIRTSGAVAGLCGLAVALSGGSAWASGFQLKEQSAEGLGNAFAGATAKAYDPSTAFYN
PAGLTRLKGTQADSVLTYIMPKAHFSGSGTNALGGSTGSIEGGDAVADAAVPSFYGVYSY
NDDLKFGIAANVPFGLRTDYDKNWAGRYQAIESDLQIVTLTPSVAYRVVGDSSFGDFSIG
GGPVVQFASVKLTNAVNNFGLVAGDGRAKVSGSDIGYGFNIGALWEPTETTRIGVNYRSR
VEHNFDGDAKYTNVARPLAISRGLVNSGASADLTTPDVVSIGAYHEFDPQWAVTADVAWT
NWSLFDELKIENDKGGVITRVDESWEDTMFVALGGIYKPVEDVALRIGVAYDQAPVGKKH
RTARIPDTNRYWLAAGVSYAVTDSFSLDASYAHIFADRVSINETTAQGNLTGTYDSSIDI
LSASATLRF