Protein Info for Rru_A1312 in Rhodospirillum rubrum S1H

Annotation: AMP-dependent synthetase and ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 85 to 103 (19 residues), see Phobius details amino acids 252 to 278 (27 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details PF00501: AMP-binding" amino acids 33 to 417 (385 residues), 319.4 bits, see alignment E=3e-99 PF13193: AMP-binding_C" amino acids 468 to 542 (75 residues), 69 bits, see alignment E=5.6e-23

Best Hits

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 100% identity to rru:Rru_A1312)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUT2 at UniProt or InterPro

Protein Sequence (564 amino acids)

>Rru_A1312 AMP-dependent synthetase and ligase (NCBI) (Rhodospirillum rubrum S1H)
MMHDSPLPPSSLTTAPRLPLPSGPVCAMLDAIIARFPDNPAIDFLGRKWTYRELGEQIDR
ACAGFQSLGVEPGTRVGLCLPNTPYYIICYYGVLKAGGIVVNFNPLYVERELRELVEDSG
TTLMVTLDLRQIYPKVAALLGDTALERIVVCSMSAILPSVKSLLFSVLKRSELADVPTDR
RHIGFAKLIATKTPPRPVAIDPATAVAVLQYTGGTTGLPKGAMLTHANVTGNLTQILGWF
PEARWGEEKMLAVLPFFHVFAMTVAMNVALALGAELILLPRFDLETVLKTIARKKPTLFP
GVPTIYSAIIGAVAKTPYDLSSLRFCLSGGAPLPIEVKTRFEELTGCTLIEGYGLSEASP
VVCCNPLDGAIKPGSIGQPLPGTTVEIRSVLDPALIVPRGERGEICVRGPQVMAGYWRRP
QDTEDTFIDGALRTGDIGYIDDEGYVFLVDRIKDVILCGGYNVYPRIIEEALYQHEAVAE
AVVIGLPDDYRGEAPKAFVRLRDGHSATPEDLKTYLATQISRIEMPKTIELRDDLPRTMV
GKLSKKALVDEERAKALAGADKAS