Protein Info for Rru_A1299 in Rhodospirillum rubrum S1H

Annotation: FAD linked oxidase-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01565: FAD_binding_4" amino acids 41 to 177 (137 residues), 133 bits, see alignment E=6.1e-43 PF02913: FAD-oxidase_C" amino acids 214 to 454 (241 residues), 217.6 bits, see alignment E=2.3e-68

Best Hits

Swiss-Prot: 53% identical to LDHD_MOUSE: Probable D-lactate dehydrogenase, mitochondrial (Ldhd) from Mus musculus

KEGG orthology group: K00102, D-lactate dehydrogenase (cytochrome) [EC: 1.1.2.4] (inferred from 100% identity to rru:Rru_A1299)

Predicted SEED Role

"D-Lactate dehydrogenase, cytochrome c-dependent (EC 1.1.2.4)" in subsystem Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 1.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.4

Use Curated BLAST to search for 1.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUU5 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Rru_A1299 FAD linked oxidase-like (NCBI) (Rhodospirillum rubrum S1H)
MSLSAAALSDLSALLGERLVLSQAVRDHHGHGESWHGVQAPEAVAFLKTAEEAQAVVALC
AAHGVPMVPFGAGSSMEGQVQATAGGLCLDMSAMTAILAVRPEDMDCTVQPGVTRQQLNE
HLRAQGLFFPIDPGAEATLGGMASTRASGTNAVRYGTMRDVVLALEVVLADGRRLRTGSR
ARKSAAGYDLTRLMIGAEGTLGLITELTLRLFPIPEKQAAAICSFPSLEQAVACVVATAQ
CGVGMSRIEFADRLQMRAINAYSHTNFPESPMLFLEFAGSAAAVEAEIATVRALADEHGG
GGFAWAESEEDRRALWKARHSAAYAALALRPGCKGLATDVCVPISRLVDCLVETQKDLAT
SPLPAPIAGHVGDGNFHLMIVFDPADPAEVAEAKRLDDALGRRALAMEGTCTGEHGIGLG
KRGLLALEAGEGVDVMRQIKAALDPKGLMNPGKIFL