Protein Info for Rru_A1272 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase (GGDEF domain) with PAS/PAC sensor domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 332 to 457 (126 residues), 84.4 bits, see alignment E=7.3e-28 PF00989: PAS" amino acids 335 to 447 (113 residues), 54.4 bits, see alignment E=3e-18 PF13188: PAS_8" amino acids 338 to 380 (43 residues), 20.1 bits, see alignment 1.2e-07 PF08448: PAS_4" amino acids 345 to 451 (107 residues), 27.4 bits, see alignment E=8.5e-10 PF13426: PAS_9" amino acids 346 to 449 (104 residues), 55.2 bits, see alignment E=1.9e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 458 to 621 (164 residues), 163.9 bits, see alignment E=2.7e-52 PF00990: GGDEF" amino acids 461 to 619 (159 residues), 148.1 bits, see alignment E=5e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1272)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUX2 at UniProt or InterPro

Protein Sequence (632 amino acids)

>Rru_A1272 Putative diguanylate cyclase (GGDEF domain) with PAS/PAC sensor domain (NCBI) (Rhodospirillum rubrum S1H)
MKRVPWVVGGLILIMAYNAALGTLAYWQRRDIIDESLREAVVVADILVREVEANLDRIDR
TLSGLTEVLRAYPSAIDVHDPFTHRLLLRRHAITPSLAALFLIGGDGRLRNASLTDKVSE
IDVSGEDYFAFHLSNVDDEFFIGAVTTNRLDKSWVIPVSRAVRDSFGRLTGVVAATITTD
SIDQMIHSHQLSEGFAVTITQRDAGMIGCLGFTRCWGEGAPHRGDEGLAESGGSGEEVHY
LPNGPGVGAFLRGPTYGVEVTVQASDRTLLQPWREKLAFILVLQVFGTLGLGFGITSLYY
QMHHRRVSLLDLERANASLESKVAERTRQLAEGEERMRGFIMAARDAVVIIDQKGIISEF
NPSATELFGYDVEEVRGQSVNMLMPATYARDHDGHLRKGKPSGQRAIGRGREMIGRRKNG
SEFPIELTVGTQSFDGTRVHIGVIRDITERKATEETLRRLANIDGLTGVLNRRSFTEESE
LLLSLANRHGRRLSMMIVDADHFKGVNDTYGHDAGDRVLKALTGEIAGVLRKTDLLGRIG
GEEFAILLPETDQEGAEGLAWRVVLAIRALEVPLPEGGVLKVTVSVGVSCRNTEAATFDW
MLKEADTALYAAKHGGRDRVACFGQTQSVARS