Protein Info for Rru_A1264 in Rhodospirillum rubrum S1H

Annotation: Short-chain dehydrogenase/reductase SDR (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00106: adh_short" amino acids 10 to 197 (188 residues), 194.8 bits, see alignment E=1.6e-61 PF08659: KR" amino acids 12 to 160 (149 residues), 43.7 bits, see alignment E=4.6e-15 PF13561: adh_short_C2" amino acids 18 to 257 (240 residues), 207.3 bits, see alignment E=4e-65

Best Hits

Swiss-Prot: 41% identical to BACC_BACSU: Dihydroanticapsin 7-dehydrogenase (bacC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1264)

MetaCyc: 41% identical to dihydroanticapsin dehydrogenase (Bacillus subtilis)
RXN-16285 [EC: 1.1.1.385]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.385

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUY0 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Rru_A1264 Short-chain dehydrogenase/reductase SDR (NCBI) (Rhodospirillum rubrum S1H)
MGVQGLLRDKVALVTGGANGIGRAAARALYGAGARVVIADLDQMAAERAAEAMGGDVLGL
PVDVRDRTSMQTCVDRAIASCGGIDILVANAGVSSMRKAVELTDEDWAFNFDVNAKGVFL
ANQLVVRHFLATGRKGVIVNTASLAAKVGAPLLAHYAASKFAVLGWTQSLARELAPEGIR
VNAVCPGFVRTPMQDREIIWEGELRGMTPEDVRKEYVALTPLGRIEEPEDVADVILFLAS
DLSRFMTGQGINVTGGIKMD