Protein Info for Rru_A1263 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 263 (178 residues), 57.6 bits, see alignment E=7e-20

Best Hits

Swiss-Prot: 34% identical to Y4OR_SINFN: Probable ABC transporter permease protein y4oR (NGR_a02180) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1263)

MetaCyc: 36% identical to polyol ABC-type transporter permease component MtlG (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUY1 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Rru_A1263 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MRRLRSLLPHLILVTFSAVILVPLLWVLRVSLTDKRTAYRLPPEFSALTFENYLAVFQDY
SFAGWFTNSMTVALAATLISLPAAATMAYASARFRTGGPVLWIGVLAGQMLPPIILVLPM
FMLFGTVLSLDGRIAIIVAHVALNLPFMAWMMTSFFEGDIRSLEEAARVDGASRLQALVR
IALPVAAPGILAAALLGFILSWNEFLYALVLGDYSSQTLPVGLAGLETHAGVEIASLAAA
ALLALAPVLILLPLLRKYLIKGLSLGALK