Protein Info for Rru_A1261 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 165 to 192 (28 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 240 to 241 (2 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 294 (200 residues), 63 bits, see alignment E=1.5e-21

Best Hits

Swiss-Prot: 35% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to rru:Rru_A1261)

MetaCyc: 32% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUY3 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Rru_A1261 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MSGAADRPMTALERADRRFGWFLTLPGVLMLAATIAFPLLWAVATSLFDFTLIAPTYDTF
VGLDNYALALGNTEFLHASWLTVGFVVAVVLIEFAIGFLIALMLNGVRRGKPIYYAILLC
PLLINPVVVGLVWRMVLHPTLGVANYALGLIGLSPVNWLGDVTVAFWTLVGVDIWHQVSF
MIVLLLAGLSALPAEPYEAARVDGASVFQRFWHITLPLMRRVILVTLLIRMIFAVKTYDL
VYIMTRGGPGTATDLVSYSIYRTAFVGLNLGQATAMAGLLLIPVLGITAYLYRLMRKA