Protein Info for Rru_A1239 in Rhodospirillum rubrum S1H

Annotation: Glutamate 5-kinase, ProB-related (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 2 to 358 (357 residues), 380.5 bits, E=4.3e-118
• PF00696: AA_kinase
  • amino acids 2 to 227 (226 residues), 148.7 bits, E=2.3e-47
• PF01472: PUA
  • amino acids 270 to 342 (73 residues), 67.1 bits, E=1.1e-22

Best Hits

Swiss-Prot: 100% identical to PROB_RHORT: Glutamate 5-kinase (proB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to rru:Rru_A1239)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-N^δ-acetylornithine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

See Q2RV05 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Rru_A1239 Glutamate 5-kinase, ProB-related (NCBI) (Rhodospirillum rubrum S1H)
MIKIGSALLVDQGSGLVRTGWLKALAEDIAQLRAEGREVLIVSSGAIAVGRRSLHLEPGR
MRLDEKQAAAAAGQIELAHAYRTVMADHAINVAQLLLTLDDSENRRRYLNARNCLETLLR
LGVIPVINENDTVTTQEIRFGDNDRLAARVAQMACADALILLSDIDGLYTADPHRDPEAR
FIPTVTALTPEIAAMAGAALTPHGTGGMVTKLLAARICMDAGCAMAIAPGKDDHALRLLR
QGGRQTWFLPAEEPRTARKAWISGALKAEGTLWVDDGAARALAAGSSLLPPGVRTVEGDF
QRGAAVRVVGLDGSPLAKGLIAYPSDEARLLVGHRSGDIEALLGYRGREELIHRDDLVLD
SRFRHRDEDGEGHRS